PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006597m
Common NameCARUB_v10006597mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 241aa    MW: 27924.4 Da    PI: 7.3457
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006597mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.6e-161559146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     ++rWT  E+++l+d+v ++G + Wk Ia++m+ +Rt ++c+ rw++
  Carubv10006597m 15 KDRWTDSEELKLKDLVGLYGLDKWKIIAEKMQ-TRTSNSCRMRWYN 59
                     68******************************.************9 PP

2Myb_DNA-binding44.14.6e-1470111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +T++Ede ++ a +++G++ W++Ia+ +  gRt +++k+rw+ +
  Carubv10006597m  70 FTEDEDEVILVAQRLFGNK-WSKIAKLLE-GRTNNDVKNRWRVL 111
                      8******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.691065IPR017930Myb domain
SuperFamilySSF466895.39E-2614108IPR009057Homeodomain-like
SMARTSM007174.8E-151463IPR001005SANT/Myb domain
PfamPF002493.7E-141559IPR001005SANT/Myb domain
CDDcd001678.60E-131761No hitNo description
Gene3DG3DSA:1.10.10.602.8E-201768IPR009057Homeodomain-like
SMARTSM007174.1E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129414.07966116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-1869112IPR009057Homeodomain-like
CDDcd001678.05E-970111No hitNo description
PfamPF002497.9E-1270111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MHQESTVQKK VIRRKDRWTD SEELKLKDLV GLYGLDKWKI IAEKMQTRTS NSCRMRWYNE  60
LNPKTNQADF TEDEDEVILV AQRLFGNKWS KIAKLLEGRT NNDVKNRWRV LQSRCPRETT  120
SAQTSCWVHS EFLMFFYEAM DEFHNYRSNM LNEETTNLHA QYLQEENNSS RMPEQHSGHH  180
HHFSTIFPAD PLALFTPHVS IPQPPPPPPS APFSLPSPGA ADAMTRKTPK FFDFLGVGDS  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-251810810100B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285236.10.0hypothetical protein CARUB_v10006597mg
TrEMBLR0GML00.0R0GML0_9BRAS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3354122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.21e-50myb domain protein 110